ATG3 Antibody - middle region : FITC

ATG3 Antibody - middle region : FITC
Artikelnummer
AVIARP59069_P050FITC
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: Autophagy is a process of bulk degradation of cytoplasmic components by the lysosome or vacuole. Human ATG3 displays the same enzymatic characteristics in vitro as yeast Apg3, a protein-conjugating enzyme essential for autophagy (Tanida et al., 2002 [PubMed 11825910]).

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human ATG3

Molecular Weight: 36kDa

Peptide Sequence: Synthetic peptide located within the following region: SDELEAIIEEDDGDGGWVDTYHNTGITGITEAVKEITLENKDNIRLQDCS

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Ubiquitin-like-conjugating enzyme ATG3

Protein Size: 314

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP59069_P050FITC
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP59069_P050-FITC
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 64422
Wirt Rabbit
Konjugat Conjugated, FITC
Produktinformation (PDF) Download
MSDS (PDF)
×