ATG4A Antibody - middle region : Biotin

ATG4A Antibody - middle region : Biotin
Artikelnummer
AVIARP58927_P050-Btn
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: Biotin

Description of Target: Autophagy is the process by which endogenous proteins and damaged organelles are destroyed intracellularly. Autophagy is postulated to be essential for cell homeostasis and cell remodeling during differentiation, metamorphosis, non-apoptotic cell death, and aging. Reduced levels of autophagy have been described in some malignant tumors, and a role for autophagy in controlling the unregulated cell growth linked to cancer has been proposed. This gene encodes a member of the autophagin protein family. The encoded protein is also designated as a member of the C-54 family of cysteine proteases. Transcript variants that encode distinct isoforms have been identified.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human ATG4A

Molecular Weight: 28kDa

Peptide Sequence: Synthetic peptide located within the following region: AVYVSMDNTVVIEDIKKMCRVLPLSADTAGDRPPDSLTASNQSDELIFLD

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: cysteine protease ATG4A

Protein Size: 259

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP58927_P050-Btn
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP58927_P050-Biotin
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Rat (Rattus)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 115201
Wirt Rabbit
Konjugat Conjugated, Biotin
Produktinformation (PDF) Download
MSDS (PDF)
×