ATG4C Antibody - middle region : Biotin

ATG4C Antibody - middle region : Biotin
Artikelnummer
AVIARP58863_P050-Btn
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: Biotin

Description of Target: Autophagy is the process by which endogenous proteins and damaged organelles are destroyed intracellularly. Autophagy is postulated to be essential for cell homeostasis and cell remodeling during differentiation, metamorphosis, non-apoptotic cell death, and aging. Reduced levels of autophagy have been described in some malignant tumors, and a role for autophagy in controlling the unregulated cell growth linked to cancer has been proposed. This gene encodes a member of the autophagin protein family. The encoded protein is also designated as a member of the C-54 family of cysteine proteases. Alternate transcriptional splice variants, encoding the same protein, have been characterized.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human ATG4C

Molecular Weight: 52kDa

Peptide Sequence: Synthetic peptide located within the following region: TISLKETIGKYSDDHEMRNEVYHRKIISWFGDSPLALFGLHQLIEYGKKS

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Cysteine protease ATG4C

Protein Size: 458

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP58863_P050-Btn
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP58863_P050-Biotin
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Dog (Canine), Cow (Bovine), Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 84938
Wirt Rabbit
Konjugat Conjugated, Biotin
Produktinformation (PDF) Download
MSDS (PDF)
×