Atg7 Antibody - C-terminal region : Biotin

Conjugation: Biotin

Description of Target: Atg7 functions as an E1 enzyme essential for multisubstrates such as ATG8-like proteins and ATG12. It forms intermediate conjugates with ATG8-like proteins (GABARAP, GABARAPL1, GABARAPL2 or MAP1LC3A). PE-conjugation to ATG8-like proteins is essential for autophagy. It also acts as an E1 enzyme for ATG12 conjugation to ATG5 and ATG3.

Immunogen: The immunogen is a synthetic peptide directed towards the C-terminal region of Rat Atg7

Molecular Weight: 76kDa

Peptide Sequence: Synthetic peptide located within the following region: KLVINAALGFDTFVVMRHGLKKPKQQGAGDLCPSHLVAPADLGSSLFANI

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Ubiquitin-like modifier-activating enzyme ATG7

Protein Size: 698

Purification: Affinity Purified

• Artikelnummer: AVIARP59072_P050-Btn
• Hersteller: Aviva Systems Biology
• Hersteller Artikelnummer: ARP59072_P050-Biotin
• Verpackungseinheit: 100μl
• Mengeneinheit: STK
• Reaktivität: Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
• Klonalität: Polyclonal
• Methode: Western Blotting
• Human Gene ID: 312647
• Wirt: Rabbit
• Konjugat: Conjugated, Biotin