ATP6V0D2 Antibody - middle region : FITC

Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: ATP6V0D2 is the subunit of the integral membrane V0 complex of vacuolar ATPase. Vacuolar ATPase is responsible for acidifying a variety of intracellular compartments in eukaryotic cells, thus providing most of the energy required for transport processes in the vacuolar system. ATP6V0D2 may play a role in coupling of proton transport and ATP hydrolysis.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human ATP6V0D2

Key Reference: Fridy,P.C., (2003) Biol. Cell 95 (7), 453-457

Molecular Weight: 40kDa

Peptide Sequence: Synthetic peptide located within the following region: GLRLLAQAEDFDQMKNVADHYGVYKPLFEAVGGSGGKTLEDVFYEREVQM

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: V-type proton ATPase subunit d 2

Protein Size: 350

Purification: Affinity Purified

Subunit: d 2

• Artikelnummer: AVIARP55487_P050FITC
• Hersteller: Aviva Systems Biology
• Hersteller Artikelnummer: ARP55487_P050-FITC
• Green Labware: Nein
• Verpackungseinheit: 100μl
• Mengeneinheit: STK
• Reaktivität: Human, Mouse (Murine), Rat (Rattus), Pig (Porcine), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
• Klonalität: Polyclonal
• Methode: Western Blotting
• Human Gene ID: 245972
• Wirt: Rabbit