English
ATP6V1E2 Antibody - middle region : FITC
ATP6V1E2 Antibody - middle region : FITC
Artikelnummer
AVIARP58590_P050FITC
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology
Verfügbarkeit:
wird geladen...
Preis wird geladen...
Conjugation: FITC: Fluorescein Isothiocyanate
Description of Target: ATP6V1E2 is a subunit of the peripheral V1 complex of vacuolar ATPase essential for assembly or catalytic function. V-ATPase is responsible for acidifying a variety of intracellular compartments in eukaryotic cells. This isoform is essential for energy coupling involved in acidification of acrosome.
Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human ATP6V1E2
Key Reference: Hillier,L.W., (2005) Nature 434 (7034), 724-731
Molecular Weight: 26kDa
Peptide Sequence: Synthetic peptide located within the following region: LMSTMRNQARLKVLRARNDLISDLLSEAKLRLSRIVEDPEVYQGLLDKLV
Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.
Protein Name: V-type proton ATPase subunit E 2
Protein Size: 226
Purification: Affinity Purified
Subunit: E 2
Description of Target: ATP6V1E2 is a subunit of the peripheral V1 complex of vacuolar ATPase essential for assembly or catalytic function. V-ATPase is responsible for acidifying a variety of intracellular compartments in eukaryotic cells. This isoform is essential for energy coupling involved in acidification of acrosome.
Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human ATP6V1E2
Key Reference: Hillier,L.W., (2005) Nature 434 (7034), 724-731
Molecular Weight: 26kDa
Peptide Sequence: Synthetic peptide located within the following region: LMSTMRNQARLKVLRARNDLISDLLSEAKLRLSRIVEDPEVYQGLLDKLV
Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.
Protein Name: V-type proton ATPase subunit E 2
Protein Size: 226
Purification: Affinity Purified
Subunit: E 2
| Artikelnummer | AVIARP58590_P050FITC |
|---|---|
| Hersteller | Aviva Systems Biology |
| Hersteller Artikelnummer | ARP58590_P050-FITC |
| Verpackungseinheit | 100μl |
| Mengeneinheit | STK |
| Reaktivität | Human, Mouse (Murine), Rat (Rattus), Sheep (Ovine), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine) |
| Klonalität | Polyclonal |
| Methode | Western Blotting |
| Human Gene ID | 90423 |
| Wirt | Rabbit |
| Konjugat | Conjugated, FITC |
| Produktinformation (PDF) | Download |
| MSDS (PDF) |
|
Verwandte Artikel
Markieren Sie die Artikel, um Sie dem Warenkorb hinzuzufügen oder
Immer für Sie da
Gernot Ensinger, M.Sc.
