ATP6V1E2 Antibody - middle region : HRP

ATP6V1E2 Antibody - middle region : HRP
Artikelnummer
AVIARP58590_P050-HRP
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: HRP: Horseradish Peroxidase

Description of Target: ATP6V1E2 is a subunit of the peripheral V1 complex of vacuolar ATPase essential for assembly or catalytic function. V-ATPase is responsible for acidifying a variety of intracellular compartments in eukaryotic cells. This isoform is essential for energy coupling involved in acidification of acrosome.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human ATP6V1E2

Key Reference: Hillier,L.W., (2005) Nature 434 (7034), 724-731

Molecular Weight: 26kDa

Peptide Sequence: Synthetic peptide located within the following region: LMSTMRNQARLKVLRARNDLISDLLSEAKLRLSRIVEDPEVYQGLLDKLV

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: V-type proton ATPase subunit E 2

Protein Size: 226

Purification: Affinity Purified

Subunit: E 2
Mehr Informationen
Artikelnummer AVIARP58590_P050-HRP
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP58590_P050-HRP
Green Labware Nein
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Sheep (Ovine), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 90423
Wirt Rabbit
Produktinformation (PDF) Download
MSDS (PDF)
×