Banf2 Antibody - N-terminal region : FITC

Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: Banf2 may play a role in BANF1 regulation and influence tissue-specific roles of BANF1.

Molecular Weight: 10kDa

Peptide Sequence: Synthetic peptide located within the following region: DDMSPRLRAFLSEPIGEKDVAWVDGISRELAINLVTKGFNKAYVLLGQFL

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Barrier-to-autointegration factor-like protein

Protein Size: 90

Purification: Affinity Purified

• Artikelnummer: AVIARP58592_P050FITC
• Hersteller: Aviva Systems Biology
• Hersteller Artikelnummer: ARP58592_P050-FITC
• Verpackungseinheit: 100μl
• Mengeneinheit: STK
• Reaktivität: Human, Mouse (Murine), Rat (Rattus), Pig (Porcine), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
• Klonalität: Polyclonal
• Methode: Western Blotting
• Human Gene ID: 403171
• Wirt: Rabbit
• Konjugat: Conjugated, FITC