Bax Antibody - middle region : Biotin

Bax Antibody - middle region : Biotin
Artikelnummer
AVIARP58871_P050-Btn
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: Biotin

Description of Target: Bax is a bcl2-related gene and is involved in the regulation of apoptotic cell death.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of Rat Bax

Molecular Weight: 21kDa

Peptide Sequence: Synthetic peptide located within the following region: PQDASTKKLSECLRRIGDELDNNMELQRMIADVDTDSPREVFFRVAADMF

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Apoptosis regulator BAX Ensembl ENSRNOP00000028328

Protein Size: 192

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP58871_P050-Btn
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP58871_P050-Biotin
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Sheep (Ovine), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Goat (Caprine), Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 24887
Wirt Rabbit
Konjugat Conjugated, Biotin
Produktinformation (PDF) Download
MSDS (PDF)
×