Bax Antibody - middle region : HRP

Bax Antibody - middle region : HRP
Artikelnummer
AVIARP58871_P050-HRP
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: HRP: Horseradish Peroxidase

Description of Target: Bax is a bcl2-related gene and is involved in the regulation of apoptotic cell death.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of Rat Bax

Molecular Weight: 21kDa

Peptide Sequence: Synthetic peptide located within the following region: PQDASTKKLSECLRRIGDELDNNMELQRMIADVDTDSPREVFFRVAADMF

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: Apoptosis regulator BAX Ensembl ENSRNOP00000028328

Protein Size: 192

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP58871_P050-HRP
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP58871_P050-HRP
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Sheep (Ovine), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Goat (Caprine), Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 24887
Wirt Rabbit
Konjugat Conjugated, HRP
Produktinformation (PDF) Download
MSDS (PDF)
×