BCL2 Antibody - middle region : Biotin

BCL2 Antibody - middle region : Biotin
Artikelnummer
AVIARP58872_P050-Btn
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: Biotin

Description of Target: This gene encodes an integral outer mitochondrial membrane protein that blocks the apoptotic death of some cells such as lymphocytes. Constitutive expression of BCL2, such as in the case of translocation of BCL2 to Ig heavy chain locus, is thought to be the cause of follicular lymphoma. Two transcript variants, produced by alternate splicing, differ in their C-terminal ends.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human BCL2

Molecular Weight: 26kDa

Peptide Sequence: Synthetic peptide located within the following region: ALSPVPPVVHLTLRQAGDDFSRRYRRDFAEMSSQLHLTPFTARGRFATVV

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Apoptosis regulator Bcl-2

Protein Size: 239

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP58872_P050-Btn
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP58872_P050-Biotin
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Pig (Porcine), Sheep (Ovine), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 596
Wirt Rabbit
Konjugat Conjugated, Biotin
Produktinformation (PDF) Download
MSDS (PDF)
×