BCL2 Antibody - middle region : HRP

Conjugation: HRP: Horseradish Peroxidase

Description of Target: This gene encodes an integral outer mitochondrial membrane protein that blocks the apoptotic death of some cells such as lymphocytes. Constitutive expression of BCL2, such as in the case of translocation of BCL2 to Ig heavy chain locus, is thought to be the cause of follicular lymphoma. Two transcript variants, produced by alternate splicing, differ in their C-terminal ends.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human BCL2

Molecular Weight: 26kDa

Peptide Sequence: Synthetic peptide located within the following region: ALSPVPPVVHLTLRQAGDDFSRRYRRDFAEMSSQLHLTPFTARGRFATVV

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: Apoptosis regulator Bcl-2

Protein Size: 239

Purification: Affinity Purified

• Artikelnummer: AVIARP58872_P050-HRP
• Hersteller: Aviva Systems Biology
• Hersteller Artikelnummer: ARP58872_P050-HRP
• Verpackungseinheit: 100μl
• Mengeneinheit: STK
• Reaktivität: Human, Mouse (Murine), Rat (Rattus), Pig (Porcine), Sheep (Ovine), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
• Klonalität: Polyclonal
• Methode: Western Blotting
• Human Gene ID: 596
• Wirt: Rabbit
• Konjugat: Conjugated, HRP