BECN1 Antibody - middle region : Biotin

BECN1 Antibody - middle region : Biotin
Artikelnummer
AVIARP58874_P050-Btn
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: Biotin

Description of Target: BECN1 plays a central role in autophagy. BECN1 may play a role in antiviral host defense. BECN1 protects against infection by a neurovirulent strain of Sindbis virus.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human BECN1

Molecular Weight: 50kDa

Peptide Sequence: Synthetic peptide located within the following region: ENLEKVQAEAERLDQEEAQYQREYSEFKRQQLELDDELKSVENQMRYAQT

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Beclin-1

Protein Size: 450

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP58874_P050-Btn
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP58874_P050-Biotin
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Pig (Porcine), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 8678
Wirt Rabbit
Konjugat Conjugated, Biotin
Produktinformation (PDF) Download
MSDS (PDF)
×