BECN1 Antibody - N-terminal region : HRP

Conjugation: HRP: Horseradish Peroxidase

Description of Target: BECN1 plays a central role in autophagy. BECN1 may play a role in antiviral host defense. BECN1 protects against infection by a neurovirulent strain of Sindbis virus.

Immunogen: The immunogen is a synthetic peptide directed towards the N-terminal region of Human BECN1

Molecular Weight: 49kDa

Peptide Sequence: Synthetic peptide located within the following region: PLLTTAQAKPGETQEEETNSGEEPFIETPRQDGVSRRFIPPARMMSTESA

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: Beclin-1

Protein Size: 450

Purification: Affinity Purified

• Artikelnummer: AVIARP58873_P050-HRP
• Hersteller: Aviva Systems Biology
• Hersteller Artikelnummer: ARP58873_P050-HRP
• Verpackungseinheit: 100μl
• Mengeneinheit: STK
• Reaktivität: Human, Mouse (Murine), Rat (Rattus), Pig (Porcine), Dog (Canine), Cow (Bovine), Horse (Equine)
• Klonalität: Polyclonal
• Methode: Western Blotting
• Human Gene ID: 8678
• Wirt: Rabbit
• Konjugat: Conjugated, HRP