BLMH Antibody - middle region : Biotin

BLMH Antibody - middle region : Biotin
Artikelnummer
AVIARP56106_P050-Btn
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: Biotin

Description of Target: The normal physiological role of BLM hydrolase is unknown, but it catalyzes the inactivation of the antitumor drug BLM (a glycopeptide) by hydrolyzing the carboxamide bond of its B-aminoalaninamide moiety thus protecting normal and malignant cells from BLM toxicity.Bleomycin hydrolase (BMH) is a cytoplasmic cysteine peptidase that is highly conserved through evolution; however, the only known activity of the enzyme is metabolic inactivation of the glycopeptide bleomycin (BLM), an essential component of combination chemotherapy regimens for cancer. The protein contains the signature active site residues of the cysteine protease papain superfamily. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human BLMH

Key Reference: de (2008) J. Clin. Oncol. 26 (11), 1817-1823

Molecular Weight: 52kDa

Peptide Sequence: Synthetic peptide located within the following region: EYLSNMVGGRKTLYNNQPIDFLKKMVAASIKDGEAVWFGCDVGKHFNSKL

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Bleomycin hydrolase

Protein Size: 455

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP56106_P050-Btn
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP56106_P050-Biotin
Green Labware Nein
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 642
Wirt Rabbit
Produktinformation (PDF) Download
MSDS (PDF)
×