English
BMP5 antibody
BMP5 antibody
Artikelnummer
GTX03273-100
Verpackungseinheit
100 μg
Hersteller
GeneTex
Verfügbarkeit:
wird geladen...
Preis wird geladen...
Application Note: WB: 0.1-0.5μg/ml. IHC-P: 0.5-1μg/ml. FACS: 1-3μg/1x10⁶ cells. ELISA: 0.1-0.5μg/ml. *Optimal dilutions/concentrations should be determined by the researcher.Not tested in other applications.
Calculated MW: 52
Form: Liquid
Buffer (with preservative): 5mg BSA, 0.9mg NaCl, 0.2mg Na₂HPO₄, 0.05mg Sodium azide.
Concentration: 0.5 mg/ml (Please refer to the vial label for the specific concentration.)
Background: This gene encodes a secreted ligand of the TGF-beta (transforming growth factor-beta) superfamily of proteins. Ligands of this family bind various TGF-beta receptors leading to recruitment and activation of SMAD family transcription factors that regulate gene expression. The encoded preproprotein is proteolytically processed to generate each subunit of the disulfide-linked homodimer, which plays a role in bone and cartilage development. Polymorphisms in this gene may be associated with osteoarthritis in human patients. This gene is differentially regulated in multiple human cancers. This gene encodes distinct protein isoforms that may be similarly proteolytically processed. [provided by RefSeq, Jul 2016]
Uniprot ID: P22003
Antigen Species: Human
Immunogen: A synthetic peptide corresponding to a sequence at the C-terminus of human BMP-5 (332-365aa HQDSSRMSSVGDYNTSEQKQACKKHELYVSFRDL), different from the related mouse sequence by three amino acids.
Purification: Purified by antigen-affinity chromatography
Conjugation: Unconjugated
Full Name: bone morphogenetic protein 5
Calculated MW: 52
Form: Liquid
Buffer (with preservative): 5mg BSA, 0.9mg NaCl, 0.2mg Na₂HPO₄, 0.05mg Sodium azide.
Concentration: 0.5 mg/ml (Please refer to the vial label for the specific concentration.)
Background: This gene encodes a secreted ligand of the TGF-beta (transforming growth factor-beta) superfamily of proteins. Ligands of this family bind various TGF-beta receptors leading to recruitment and activation of SMAD family transcription factors that regulate gene expression. The encoded preproprotein is proteolytically processed to generate each subunit of the disulfide-linked homodimer, which plays a role in bone and cartilage development. Polymorphisms in this gene may be associated with osteoarthritis in human patients. This gene is differentially regulated in multiple human cancers. This gene encodes distinct protein isoforms that may be similarly proteolytically processed. [provided by RefSeq, Jul 2016]
Uniprot ID: P22003
Antigen Species: Human
Immunogen: A synthetic peptide corresponding to a sequence at the C-terminus of human BMP-5 (332-365aa HQDSSRMSSVGDYNTSEQKQACKKHELYVSFRDL), different from the related mouse sequence by three amino acids.
Purification: Purified by antigen-affinity chromatography
Conjugation: Unconjugated
Full Name: bone morphogenetic protein 5
| Artikelnummer | GTX03273-100 |
|---|---|
| Hersteller | GeneTex |
| Hersteller Artikelnummer | GTX03273-100 |
| Green Labware | Nein |
| Verpackungseinheit | 100 μg |
| Mengeneinheit | STK |
| Reaktivität | Human, Mouse (Murine), Rat (Rattus) |
| Klonalität | Polyclonal |
| Methode | Immunohistochemistry (paraffin), Western Blotting, ELISA, Flow Cytometry |
| Isotyp | IgG |
| Human Gene ID | 653 |
| Wirt | Rabbit |
| Produktinformation (PDF) | Download |
| MSDS (PDF) |
|
Verwandte Artikel
Markieren Sie die Artikel, um Sie dem Warenkorb hinzuzufügen oder
Immer für Sie da
Gernot Ensinger, M.Sc.
Laurent Haze
