BMP6 Antibody - middle region : HRP

Conjugation: HRP: Horseradish Peroxidase

Description of Target: The bone morphogenetic proteins (BMPs) are a family of secreted signaling molecules that can induce ectopic bone growth. Many BMPs are part of the transforming growth factor-beta (TGFB) superfamily. BMPs were originally identified by an ability of deminer

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human BMP6

Key Reference: Klink,A., (2008) Blood 111 (12), 5721-5726

Molecular Weight: 57kDa

Peptide Sequence: Synthetic peptide located within the following region: MVAFFKVSEVHVRTTRSASSRRRQQSRNRSTQSQDVARVSSASDYNSSEL

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: Bone morphogenetic protein 6

Protein Size: 513

Purification: Affinity Purified

• Artikelnummer: AVIARP58757_P050-HRP
• Hersteller: Aviva Systems Biology
• Hersteller Artikelnummer: ARP58757_P050-HRP
• Verpackungseinheit: 100μl
• Mengeneinheit: STK
• Reaktivität: Human, Mouse (Murine), Rat (Rattus), Sheep (Ovine), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Goat (Caprine), Horse (Equine)
• Klonalität: Polyclonal
• Methode: Western Blotting
• Human Gene ID: 654
• Wirt: Rabbit
• Konjugat: Conjugated, HRP