BMP6 Antibody - N-terminal region : FITC

Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: The bone morphogenetic proteins (BMPs) are a family of secreted signaling molecules that can induce ectopic bone growth. Many BMPs are part of the transforming growth factor-beta (TGFB) superfamily. BMPs were originally identified by an ability of demineralized bone extract to induce endochondral osteogenesis in vivo in an extraskeletal site. Based on its expression early in embryogenesis, the BMP encoded by this gene has a proposed role in early development. In addition, the fact that this BMP is closely related to BMP5 and BMP7 has lead to speculation of possible bone inductive activity.

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human BMP6

Molecular Weight: 57kDa

Peptide Sequence: Synthetic peptide located within the following region: DGGSPGRTEQPPPSPQSSSGFLYRRLKTQEKREMQKEILSVLGLPHRPRP

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Bone morphogenetic protein 6

Protein Size: 513

Purification: Affinity Purified

• Artikelnummer: AVIARP58756_P050FITC
• Hersteller: Aviva Systems Biology
• Hersteller Artikelnummer: ARP58756_P050-FITC
• Verpackungseinheit: 100μl
• Mengeneinheit: STK
• Reaktivität: Human, Mouse (Murine), Rat (Rattus), Pig (Porcine), Cow (Bovine)
• Klonalität: Polyclonal
• Methode: Western Blotting
• Human Gene ID: 654
• Wirt: Rabbit
• Konjugat: Conjugated, FITC