Bnip3l Antibody - middle region : Biotin

Conjugation: Biotin

Description of Target: Bnip3l induces apoptosis. It interacts with viral and cellular anti-apoptosis proteins. It can overcome the suppressors BCL-2 and BCL-XL, although high levels of BCL-XL expression will inhibit apoptosis. It inhibits apoptosis induced by BNIP3. It is involved in mitochondrial quality control via its interaction with SPATA18/MIEAP: in response to mitochondrial damage, participates to mitochondrial protein catabolic process (also named MALM) leading to the degradation of damaged proteins inside mitochondria. Bnip3l may function as a tumor suppressor.

Molecular Weight: 24kDa

Peptide Sequence: Synthetic peptide located within the following region: CDSPSPQEDGQIMFDVEMHTSRDHSSQSEEEVVEGEKEVEALKKSADWVS

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: BCL2/adenovirus E1B 19 kDa protein-interacting protein 3-like

Protein Size: 218

Purification: Affinity Purified

• Artikelnummer: AVIARP58878_P050-Btn
• Hersteller: Aviva Systems Biology
• Hersteller Artikelnummer: ARP58878_P050-Biotin
• Verpackungseinheit: 100μl
• Mengeneinheit: STK
• Reaktivität: Human, Mouse (Murine), Rat (Rattus), Pig (Porcine), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
• Klonalität: Polyclonal
• Methode: Western Blotting
• Human Gene ID: 12177
• Wirt: Rabbit
• Konjugat: Conjugated, Biotin