BTG4 Antibody - middle region : HRP

Conjugation: HRP: Horseradish Peroxidase

Description of Target: The protein encoded by this gene is a member of the BTG/Tob family. This family has structurally related proteins that appear to have antiproliferative properties. This encoded protein can induce G1 arrest in the cell cycle.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human BTG4

Molecular Weight: 26kDa

Peptide Sequence: Synthetic peptide located within the following region: ILERACVESNVDFSHLGLPKEMTIWVDPFEVCCRYGEKNHPFTVASFKGR

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: Protein BTG4

Protein Size: 223

Purification: Affinity Purified

• Artikelnummer: AVIARP56981_P050-HRP
• Hersteller: Aviva Systems Biology
• Hersteller Artikelnummer: ARP56981_P050-HRP
• Green Labware: Nein
• Verpackungseinheit: 100μl
• Mengeneinheit: STK
• Reaktivität: Human, Mouse (Murine), Rat (Rattus), Pig (Porcine), Rabbit, Dog (Canine), Cow (Bovine), Horse (Equine)
• Klonalität: Polyclonal
• Methode: Western Blotting
• Human Gene ID: 54766
• Wirt: Rabbit