English
BUB3 Antibody - N-terminal region : Biotin
BUB3 Antibody - N-terminal region : Biotin
Artikelnummer
AVIARP58599_P050-Btn
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology
Verfügbarkeit:
wird geladen...
Preis wird geladen...
Conjugation: Biotin
Description of Target: BUB3 is required for kinetochore localization of BUB1.This gene encodes a protein involved in spindle checkpoint function. The encoded protein contains four WD repeat domains and has sequence similarity with the yeast BUB3 protein. Alternate transcriptional splice variants, encoding different isoforms, have been characterized.
Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human BUB3
Key Reference: Vaclavicek,A., (2007) Breast Cancer Res. Treat. 106 (2), 205-213
Molecular Weight: 36kDa
Peptide Sequence: Synthetic peptide located within the following region: MTGSNEFKLNQPPEDGISSVKFSPNTSQFLLVSSWDTSVRLYDVPANSMR
Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.
Protein Name: Mitotic checkpoint protein BUB3
Protein Size: 326
Purification: Affinity Purified
Description of Target: BUB3 is required for kinetochore localization of BUB1.This gene encodes a protein involved in spindle checkpoint function. The encoded protein contains four WD repeat domains and has sequence similarity with the yeast BUB3 protein. Alternate transcriptional splice variants, encoding different isoforms, have been characterized.
Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human BUB3
Key Reference: Vaclavicek,A., (2007) Breast Cancer Res. Treat. 106 (2), 205-213
Molecular Weight: 36kDa
Peptide Sequence: Synthetic peptide located within the following region: MTGSNEFKLNQPPEDGISSVKFSPNTSQFLLVSSWDTSVRLYDVPANSMR
Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.
Protein Name: Mitotic checkpoint protein BUB3
Protein Size: 326
Purification: Affinity Purified
| Artikelnummer | AVIARP58599_P050-Btn |
|---|---|
| Hersteller | Aviva Systems Biology |
| Hersteller Artikelnummer | ARP58599_P050-Biotin |
| Verpackungseinheit | 100μl |
| Mengeneinheit | STK |
| Reaktivität | Human, Mouse (Murine), Rat (Rattus), Rabbit, Guinea Pig, Cow (Bovine), Horse (Equine) |
| Klonalität | Polyclonal |
| Methode | Immunofluorescence, Western Blotting, Immunohistochemistry |
| Human Gene ID | 9184 |
| Wirt | Rabbit |
| Konjugat | Conjugated, Biotin |
| Produktinformation (PDF) | Download |
| MSDS (PDF) |
|
Verwandte Artikel
Markieren Sie die Artikel, um Sie dem Warenkorb hinzuzufügen oder
Immer für Sie da
Gernot Ensinger, M.Sc.
