BXDC2 Antibody - middle region : HRP

Conjugation: HRP: Horseradish Peroxidase

Description of Target: BXDC2 is required for biogenesis of the 60S ribosomal subunit.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human BXDC2

Key Reference: 0

Molecular Weight: 41kDa

Peptide Sequence: Synthetic peptide located within the following region: ALLKELLIQIFSTPRYHPKSQPFVDHVFTFTILDNRIWFRNFQIIEEDAA

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: Ribosome biogenesis protein BRX1 homolog

Protein Size: 353

Purification: Affinity Purified

• Artikelnummer: AVIARP57201_P050-HRP
• Hersteller: Aviva Systems Biology
• Hersteller Artikelnummer: ARP57201_P050-HRP
• Green Labware: Nein
• Verpackungseinheit: 100μl
• Mengeneinheit: STK
• Reaktivität: Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine)
• Klonalität: Polyclonal
• Methode: Western Blotting
• Human Gene ID: 55299
• Wirt: Rabbit