C11orf67 Antibody - middle region : Biotin

C11orf67 Antibody - middle region : Biotin
Artikelnummer
AVIARP55391_P050-Btn
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: Biotin

Description of Target: The exact function of C11orf67 remains unknown.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human C11orf67

Key Reference: Gerhard,D.S., Genome Res. 14 (10B), 2121-2127 (2004)

Molecular Weight: 13kDa

Peptide Sequence: Synthetic peptide located within the following region: SEALKVPSSTVEYLKKHGIDVRVLQTEQAVKEYNALVAQGVRVGGVFHST

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Mth938 domain-containing protein

Protein Size: 122

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP55391_P050-Btn
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP55391_P050-Biotin
Green Labware Nein
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 28971
Wirt Rabbit
Produktinformation (PDF) Download
MSDS (PDF)
×