C11orf77 Antibody - middle region : HRP

Conjugation: HRP: Horseradish Peroxidase

Description of Target: The specific function of the protein remains unknown.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human C11orf77

Key Reference: Sinzelle,L., (2008) Proc. Natl. Acad. Sci. U.S.A. 105 (12), 4715-4720

Molecular Weight: 39kDa

Peptide Sequence: Synthetic peptide located within the following region: GVMGVVDCIHVAIKAPNAEDLSYVNRKGLHSLNCLMVCDIRGTLMTVETN

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: Putative nuclease HARBI1

Protein Size: 349

Purification: Affinity Purified

• Artikelnummer: AVIARP55708_P050-HRP
• Hersteller: Aviva Systems Biology
• Hersteller Artikelnummer: ARP55708_P050-HRP
• Green Labware: Nein
• Verpackungseinheit: 100μl
• Mengeneinheit: STK
• Reaktivität: Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine)
• Klonalität: Polyclonal
• Methode: Western Blotting
• Human Gene ID: 283254
• Wirt: Rabbit