C12orf24 Antibody - N-terminal region : Biotin

C12orf24 Antibody - N-terminal region : Biotin
Artikelnummer
AVIARP54929_P050-Btn
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: Biotin

Description of Target: The exact function of C12orf24 remains unknown.

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human C12orf24

Key Reference: Kimura,K., (2006) Genome Res. 16 (1), 55-65

Molecular Weight: 31kDa

Peptide Sequence: Synthetic peptide located within the following region: AVAGTEGGGGGSAGYSCYQNSKGSDRIKDGYKVNSHIAKLQELWKTPQNQ

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Protein FAM216A

Protein Size: 273

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP54929_P050-Btn
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP54929_P050-Biotin
Green Labware Nein
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Pig (Porcine), Cow (Bovine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 29902
Wirt Rabbit
Produktinformation (PDF) Download
MSDS (PDF)
×