C12orf42 Antibody - N-terminal region : FITC

C12orf42 Antibody - N-terminal region : FITC
Artikelnummer
AVIARP54542_P050FITC
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: The exact function of C12orf42 remains unknown.

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human C12orf42

Key Reference: Kimura,K., (2006) Genome Res. 16 (1), 55-65

Molecular Weight: 40kDa

Peptide Sequence: Synthetic peptide located within the following region: PRCSVSTVSFDEESYEEFRSSPAPSSETDEAPLIFTARGETEERARGAPK

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Uncharacterized protein C12orf42

Protein Size: 360

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP54542_P050FITC
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP54542_P050-FITC
Green Labware Nein
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 374470
Wirt Rabbit
Produktinformation (PDF) Download
MSDS (PDF)
×