C14orf104 Antibody - N-terminal region : Biotin

Conjugation: Biotin

Description of Target: The function of this protein remains unknown.

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human C14orf104

Key Reference: 0

Molecular Weight: 91kDa

Peptide Sequence: Synthetic peptide located within the following region: MFSQYAEELTDPENRRRYEAEITALERERGVEVRFVHPEPGHVLRTSLDG

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Protein kintoun

Protein Size: 837

Purification: Affinity Purified

• Artikelnummer: AVIARP57125_P050-Btn
• Hersteller: Aviva Systems Biology
• Hersteller Artikelnummer: ARP57125_P050-Biotin
• Green Labware: Nein
• Verpackungseinheit: 100μl
• Mengeneinheit: STK
• Reaktivität: Human, Mouse (Murine), Rat (Rattus), Pig (Porcine), Dog (Canine), Cow (Bovine), Horse (Equine)
• Klonalität: Polyclonal
• Methode: Western Blotting, Immunohistochemistry
• Human Gene ID: 55172
• Wirt: Rabbit