C14orf119 Antibody - N-terminal region : FITC

Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: The function of this protein remains unknown.

Immunogen: The immunogen is a synthetic peptide directed towards the N-terminal region of Human C14orf119

Molecular Weight: 15kDa

Peptide Sequence: Synthetic peptide located within the following region: SSSMPLSFPSLLPSVPHNTNPSPPLMSYITSQEMKCILHWFANWSGPQRE

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Uncharacterized protein C14orf119

Protein Size: 140

Purification: Affinity Purified

• Artikelnummer: AVIARP57065_P050FITC
• Hersteller: Aviva Systems Biology
• Hersteller Artikelnummer: ARP57065_P050-FITC
• Green Labware: Nein
• Verpackungseinheit: 100μl
• Mengeneinheit: STK
• Reaktivität: Human
• Klonalität: Polyclonal
• Methode: Western Blotting
• Human Gene ID: 55017
• Wirt: Rabbit