C16orf65 Antibody - middle region : Biotin

Conjugation: Biotin

Description of Target: The specific function of the protein remains unknown.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human C16orf65

Key Reference: Martin,J., (2004) Nature 432 (7020), 988-994

Molecular Weight: 23kDa

Peptide Sequence: Synthetic peptide located within the following region: TSTPKKIELAKDESFTSSDDNENVDLDKRLQYYRYPWSTVHHPARRPISI

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: PDZ domain-containing protein 9

Protein Size: 202

Purification: Affinity Purified

• Artikelnummer: AVIARP55697_P050-Btn
• Hersteller: Aviva Systems Biology
• Hersteller Artikelnummer: ARP55697_P050-Biotin
• Green Labware: Nein
• Verpackungseinheit: 100μl
• Mengeneinheit: STK
• Reaktivität: Human, Rat (Rattus), Rabbit, Dog (Canine)
• Klonalität: Polyclonal
• Methode: Western Blotting
• Human Gene ID: 255762
• Wirt: Rabbit