C17orf78 Antibody - middle region : FITC

Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: The exact function of the protein encoded by this gene is not known.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human C17orf78

Key Reference: Ota,T., (2004) Nat. Genet. 36 (1), 40-45

Molecular Weight: 30kDa

Peptide Sequence: Synthetic peptide located within the following region: LGARKLCQCQWLWRWQKKGGQPPGTAESKPDSQPQKVGQDAANSSNPKKA

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Uncharacterized protein C17orf78

Protein Size: 275

Purification: Affinity Purified

• Artikelnummer: AVIARP55673_P050FITC
• Hersteller: Aviva Systems Biology
• Hersteller Artikelnummer: ARP55673_P050-FITC
• Green Labware: Nein
• Verpackungseinheit: 100μl
• Mengeneinheit: STK
• Reaktivität: Human
• Klonalität: Polyclonal
• Methode: Western Blotting
• Human Gene ID: 284099
• Wirt: Rabbit