C19orf54 Antibody - N-terminal region : Biotin

C19orf54 Antibody - N-terminal region : Biotin
Artikelnummer
AVIARP55875_P050-Btn
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: Biotin

Description of Target: The specific function of this protein remains unknown.

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human C19orf54

Key Reference: Strausberg,R.L., (2002) Proc. Natl. Acad. Sci. U.S.A. 99 (26), 16899-16903

Molecular Weight: 23kDa

Peptide Sequence: Synthetic peptide located within the following region: MTSPCSPPLKPPISPPKTPVPQASSIPSPPLPPSPLDFSALPSPPWSQQT

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: UPF0692 protein C19orf54

Protein Size: 213

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP55875_P050-Btn
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP55875_P050-Biotin
Green Labware Nein
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 284325
Wirt Rabbit
Produktinformation (PDF) Download
MSDS (PDF)
×