C1orf103 Antibody - N-terminal region : FITC

Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: The specific function of this protein remains unknown.

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human C1orf103

Key Reference: Gregory,S.G., (2006) Nature 441 (7091), 315-321

Molecular Weight: 27kDa

Peptide Sequence: Synthetic peptide located within the following region: KKIFGLTKDLRVCLTRIPDHLTSGEGFDSFSSLVKSGTYKETEFMVKEGE

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Ligand-dependent nuclear receptor-interacting factor 1

Protein Size: 233

Purification: Affinity Purified

• Artikelnummer: AVIARP56173_P050FITC
• Hersteller: Aviva Systems Biology
• Hersteller Artikelnummer: ARP56173_P050-FITC
• Green Labware: Nein
• Verpackungseinheit: 100μl
• Mengeneinheit: STK
• Reaktivität: Human, Mouse (Murine), Rat (Rattus), Pig (Porcine), Rabbit, Dog (Canine), Guinea Pig, Horse (Equine)
• Klonalität: Polyclonal
• Methode: Western Blotting
• Human Gene ID: 55791
• Wirt: Rabbit