C1orf142 Antibody - middle region : Biotin

Conjugation: Biotin

Description of Target: The function of this protein remains unknown.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human C1orf142

Key Reference: Deloukas,P., (2004) Nature 429 (6990), 375-381

Molecular Weight: 51kDa

Peptide Sequence: Synthetic peptide located within the following region: TALHLQTSLPALSEADTQELTQILRRMKGLALEAESELERQDEALDGVAA

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Synaptosomal-associated protein 47

Protein Size: 464

Purification: Affinity Purified

• Artikelnummer: AVIARP58429_P050-Btn
• Hersteller: Aviva Systems Biology
• Hersteller Artikelnummer: ARP58429_P050-Biotin
• Verpackungseinheit: 100μl
• Mengeneinheit: STK
• Reaktivität: Human, Mouse (Murine), Rat (Rattus), Pig (Porcine), Rabbit, Cow (Bovine), Zebrafish, Yeast, Horse (Equine)
• Klonalität: Polyclonal
• Methode: Western Blotting
• Human Gene ID: 116841
• Wirt: Rabbit
• Konjugat: Conjugated, Biotin