C1orf190 Antibody - middle region : FITC

C1orf190 Antibody - middle region : FITC
Artikelnummer
AVIARP56202_P050FITC
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: The specific function of this protein remains unknown.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human C1orf190

Key Reference: Gregory,S.G., (2006) Nature 441 (7091), 315-321

Molecular Weight: 26kDa

Peptide Sequence: Synthetic peptide located within the following region: SIGSFLDTVAPSELDEQGPPGAPRSEMDWAKVIAGGERARTEVDVAATRL

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Leucine rich adaptor protein 1

Protein Size: 239

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP56202_P050FITC
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP56202_P050-FITC
Green Labware Nein
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Pig (Porcine), Rabbit, Dog (Canine), Cow (Bovine), Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 541468
Wirt Rabbit
Produktinformation (PDF) Download
MSDS (PDF)
×