C2orf29 Antibody - middle region : HRP

C2orf29 Antibody - middle region : HRP
Artikelnummer
AVIARP56972_P050-HRP
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: HRP: Horseradish Peroxidase

Description of Target: The function of this protein remains unknown.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human C2orf29

Key Reference: Hillier,L.W., (2005) Nature 434 (7034), 724-731

Molecular Weight: 55kDa

Peptide Sequence: Synthetic peptide located within the following region: SVDISGLQLALAERQSELPTQSKASFPSILSDPDPDSSNSGFDSSVASQI

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: UPF0760 protein C2orf29

Protein Size: 510

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP56972_P050-HRP
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP56972_P050-HRP
Green Labware Nein
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 55571
Wirt Rabbit
Produktinformation (PDF) Download
MSDS (PDF)
×