C6orf146 Antibody - middle region : FITC

Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: The specific function of C6orf146 is not yet known.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human C6orf146

Key Reference: Mungall,A.J., (2003) Nature 425 (6960), 805-811

Molecular Weight: 57kDa

Peptide Sequence: Synthetic peptide located within the following region: ETLPAPNWNLKHGNSSVEENFTDESDLSENEKTNDTLLSYFKKVDLNLKP

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Protein FAM217A

Protein Size: 508

Purification: Affinity Purified

• Artikelnummer: AVIARP55647_P050FITC
• Hersteller: Aviva Systems Biology
• Hersteller Artikelnummer: ARP55647_P050-FITC
• Green Labware: Nein
• Verpackungseinheit: 100μl
• Mengeneinheit: STK
• Reaktivität: Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
• Klonalität: Polyclonal
• Methode: Western Blotting
• Human Gene ID: 222826
• Wirt: Rabbit