C6orf182 Antibody - middle region : HRP

C6orf182 Antibody - middle region : HRP
Artikelnummer
AVIARP55720_P050-HRP
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: HRP: Horseradish Peroxidase

Description of Target: The exact functions of C6orf182 remain unknown.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human C6orf182

Molecular Weight: 54kDa

Peptide Sequence: Synthetic peptide located within the following region: LNVEREKNMILEQQAQLQREKEQDQMKLYAKLEKLDVLEKECFRLTTTQK

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: Centrosomal protein CEP57L1

Protein Size: 460

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP55720_P050-HRP
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP55720_P050-HRP
Green Labware Nein
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Yeast, Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 285753
Wirt Rabbit
Produktinformation (PDF) Download
MSDS (PDF)
×