C7orf38 Antibody - middle region : HRP

C7orf38 Antibody - middle region : HRP
Artikelnummer
AVIARP55465_P050-HRP
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: HRP: Horseradish Peroxidase

Description of Target: The exact function of this protein remains unknown. The protein is weakly similar to transposase-like proteins in human and mouse.This gene encodes a protein of unknown function. The protein is weakly similar to transposase-like proteins in human and mouse.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human C7orf38

Key Reference: Thompson,E.E., (2006) Pharmacogenomics J. 6 (2), 105-114

Molecular Weight: 66kDa

Peptide Sequence: Synthetic peptide located within the following region: QTFNYYFPEEKFESLKENIWMKDPFAFQNPESIIELNLEPEEENELLQLS

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: Protein FAM200A

Protein Size: 573

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP55465_P050-HRP
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP55465_P050-HRP
Green Labware Nein
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Pig (Porcine), Dog (Canine), Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 221786
Wirt Rabbit
Produktinformation (PDF) Download
MSDS (PDF)
×