C9orf43 Antibody - middle region : Biotin

Conjugation: Biotin

Description of Target: The function of the C9orf43 protein remains unknown.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human C9orf43

Key Reference: Humphray,S.J., (2004) Nature 429 (6990), 369-374

Molecular Weight: 52kDa

Peptide Sequence: Synthetic peptide located within the following region: PEAQAARQKKISFNFSEIMASTGWNSELKLLRILQDTDDEDEEDQSSGAE

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Uncharacterized protein C9orf43

Protein Size: 461

Purification: Affinity Purified

• Artikelnummer: AVIARP55555_P050-Btn
• Hersteller: Aviva Systems Biology
• Hersteller Artikelnummer: ARP55555_P050-Biotin
• Green Labware: Nein
• Verpackungseinheit: 100μl
• Mengeneinheit: STK
• Reaktivität: Human, Pig (Porcine), Dog (Canine), Yeast
• Klonalität: Polyclonal
• Methode: Western Blotting
• Human Gene ID: 257169
• Wirt: Rabbit