C9orf43 Antibody - middle region : HRP

C9orf43 Antibody - middle region : HRP
Artikelnummer
AVIARP55555_P050-HRP
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: HRP: Horseradish Peroxidase

Description of Target: The function of the C9orf43 protein remains unknown.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human C9orf43

Key Reference: Humphray,S.J., (2004) Nature 429 (6990), 369-374

Molecular Weight: 52kDa

Peptide Sequence: Synthetic peptide located within the following region: PEAQAARQKKISFNFSEIMASTGWNSELKLLRILQDTDDEDEEDQSSGAE

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: Uncharacterized protein C9orf43

Protein Size: 461

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP55555_P050-HRP
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP55555_P050-HRP
Green Labware Nein
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Pig (Porcine), Dog (Canine), Yeast
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 257169
Wirt Rabbit
Produktinformation (PDF) Download
MSDS (PDF)
×