C9orf75 Antibody - middle region : HRP

Conjugation: HRP: Horseradish Peroxidase

Description of Target: The specific function of C9orf75 is not yet known.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human C9orf75

Key Reference: Colland,F., (2004) Genome Res. 14 (7), 1324-1332

Molecular Weight: 72kDa

Peptide Sequence: Synthetic peptide located within the following region: PPFLPAASEEAEPAEGLRVPGLAKNSREYVRPGLPVTFIDEVDSEEAPQA

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Size: 650

Purification: Affinity Purified

• Artikelnummer: AVIARP55691_P050-HRP
• Hersteller: Aviva Systems Biology
• Hersteller Artikelnummer: ARP55691_P050-HRP
• Green Labware: Nein
• Verpackungseinheit: 100μl
• Mengeneinheit: STK
• Reaktivität: Human, Mouse (Murine), Rat (Rattus), Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
• Klonalität: Polyclonal
• Methode: Western Blotting
• Human Gene ID: 286262
• Wirt: Rabbit