CA1 Antibody - N-terminal region : Biotin

CA1 Antibody - N-terminal region : Biotin
Artikelnummer
AVIARP58432_P050-Btn
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: Biotin

Description of Target: Carbonic anhydrases (CAs) are a large family of zinc metalloenzymes that catalyze the reversible hydration of carbon dioxide. They participate in a variety of biological processes, including respiration, calcification, acid-base balance, bone resorption, and the formation of aqueous humor, cerebrospinal fluid, saliva, and gastric acid. They show extensive diversity in tissue distribution and in their subcellular localization. CA1 is closely linked to CA2 and CA3 genes on chromosome 8, and it encodes a cytosolic protein which is found at the highest level in erythrocytes. Carbonic anhydrases (CAs) are a large family of zinc metalloenzymes that catalyze the reversible hydration of carbon dioxide. They participate in a variety of biological processes, including respiration, calcification, acid-base balance, bone resorption, and the formation of aqueous humor, cerebrospinal fluid, saliva, and gastric acid. They show extensive diversity in tissue distribution and in their subcellular localization. CA1 is closely linked to CA2 and CA3 genes on chromosome 8, and it encodes a cytosolic protein which is found at the highest level in erythrocytes. Transcript variants of CA1 utilizing alternative polyA_sites have been described in literature.

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human CA1

Key Reference: Gambhir,K.K., Biochem. Genet. 45 (5-6), 431-439 (2007)

Molecular Weight: 29kDa

Peptide Sequence: Synthetic peptide located within the following region: ASPDWGYDDKNGPEQWSKLYPIANGNNQSPVDIKTSETKHDTSLKPISVS

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Carbonic anhydrase 1

Protein Size: 261

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP58432_P050-Btn
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP58432_P050-Biotin
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Rat (Rattus), Pig (Porcine), Sheep (Ovine), Dog (Canine), Guinea Pig, Cow (Bovine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 759
Wirt Rabbit
Konjugat Conjugated, Biotin
Produktinformation (PDF) Download
MSDS (PDF)
×