CAB39 Antibody - middle region : Biotin

Conjugation: Biotin

Description of Target: Together with the STE20-related adaptor-alpha (STRAD alpha) pseudo kinase, CAB39 forms a regulatory complex capable of stimulating the activity of STK11.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human CAB39

Key Reference: Ewing,R.M., Mol. Syst. Biol. 3, 89 (2007)

Molecular Weight: 40kDa

Peptide Sequence: Synthetic peptide located within the following region: KTQPILDILLKNQAKLIEFLSKFQNDRTEDEQFNDEKTYLVKQIRDLKRP

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Calcium-binding protein 39

Protein Size: 341

Purification: Affinity Purified

• Artikelnummer: AVIARP56877_P050-Btn
• Hersteller: Aviva Systems Biology
• Hersteller Artikelnummer: ARP56877_P050-Biotin
• Green Labware: Nein
• Verpackungseinheit: 100μl
• Mengeneinheit: STK
• Reaktivität: Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Yeast, Horse (Equine)
• Klonalität: Polyclonal
• Methode: Western Blotting
• Human Gene ID: 51719
• Wirt: Rabbit