Cacng1 Antibody - N-terminal region : FITC

Cacng1 Antibody - N-terminal region : FITC
Artikelnummer
AVIARP58843_P050FITC
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: This protein is a subunit of the dihydropyridine (DHP) sensitive calcium channel. Cacng1 plays a role in excitation-contraction coupling. The skeletal muscle DHP-sensitive Ca2+ channel may function only as a multiple subunit complex.

Immunogen: The immunogen is a synthetic peptide corresponding to a region of Mouse

Molecular Weight: 25kDa

Peptide Sequence: Synthetic peptide located within the following region: AVHNKDKSCEHVTPSGEKNCSYFRHFNPGESSEIFEFTTQKEYSISAAAI

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Voltage-dependent calcium channel gamma-1 subunit

Protein Size: 223

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP58843_P050FITC
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP58843_P050-FITC
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 12299
Wirt Rabbit
Konjugat Conjugated, FITC
Produktinformation (PDF) Download
MSDS (PDF)
×