Cacng1 Antibody - N-terminal region : HRP

Conjugation: HRP: Horseradish Peroxidase

Description of Target: This protein is a subunit of the dihydropyridine (DHP) sensitive calcium channel. Cacng1 plays a role in excitation-contraction coupling. The skeletal muscle DHP-sensitive Ca2+ channel may function only as a multiple subunit complex.

Immunogen: The immunogen is a synthetic peptide corresponding to a region of Mouse

Molecular Weight: 25kDa

Peptide Sequence: Synthetic peptide located within the following region: AVHNKDKSCEHVTPSGEKNCSYFRHFNPGESSEIFEFTTQKEYSISAAAI

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: Voltage-dependent calcium channel gamma-1 subunit

Protein Size: 223

Purification: Affinity Purified

• Artikelnummer: AVIARP58843_P050-HRP
• Hersteller: Aviva Systems Biology
• Hersteller Artikelnummer: ARP58843_P050-HRP
• Verpackungseinheit: 100μl
• Mengeneinheit: STK
• Reaktivität: Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
• Klonalität: Polyclonal
• Methode: Western Blotting
• Human Gene ID: 12299
• Wirt: Rabbit
• Konjugat: Conjugated, HRP