English
CALB2 Antibody - N-terminal region : FITC
CALB2 Antibody - N-terminal region : FITC
Artikelnummer
AVIARP58600_P050FITC
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology
Verfügbarkeit:
wird geladen...
Preis wird geladen...
Conjugation: FITC: Fluorescein Isothiocyanate
Description of Target: CALB2 is an intracellular calcium-binding protein belonging to the troponin C superfamily. Members of this protein family have six EF-hand domains which bind calcium. This gene encodes an intracellular calcium-binding protein belonging to the troponin C superfamily. Members of this protein family have six EF-hand domains which bind calcium. Three alternatively spliced transcript variants that encode different proteins have been described.
Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human CALB2
Key Reference: Alaeddini,M., (2008) Histopathology 52 (3), 299-304
Molecular Weight: 30kDa
Peptide Sequence: Synthetic peptide located within the following region: IIGEEDLPSEEVDQELIEDSQWEEILKQPCPSQYSAIKEEDLVVWVDPLD
Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.
Protein Name: Calretinin
Protein Size: 271
Purification: Affinity Purified
Description of Target: CALB2 is an intracellular calcium-binding protein belonging to the troponin C superfamily. Members of this protein family have six EF-hand domains which bind calcium. This gene encodes an intracellular calcium-binding protein belonging to the troponin C superfamily. Members of this protein family have six EF-hand domains which bind calcium. Three alternatively spliced transcript variants that encode different proteins have been described.
Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human CALB2
Key Reference: Alaeddini,M., (2008) Histopathology 52 (3), 299-304
Molecular Weight: 30kDa
Peptide Sequence: Synthetic peptide located within the following region: IIGEEDLPSEEVDQELIEDSQWEEILKQPCPSQYSAIKEEDLVVWVDPLD
Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.
Protein Name: Calretinin
Protein Size: 271
Purification: Affinity Purified
| Artikelnummer | AVIARP58600_P050FITC |
|---|---|
| Hersteller | Aviva Systems Biology |
| Hersteller Artikelnummer | ARP58600_P050-FITC |
| Green Labware | Nein |
| Verpackungseinheit | 100μl |
| Mengeneinheit | STK |
| Reaktivität | Human, Mouse (Murine), Rat (Rattus), Rabbit, Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine) |
| Klonalität | Polyclonal |
| Methode | Western Blotting |
| Human Gene ID | 794 |
| Wirt | Rabbit |
| Produktinformation (PDF) | Download |
| MSDS (PDF) |
|
Verwandte Artikel
Markieren Sie die Artikel, um Sie dem Warenkorb hinzuzufügen oder
Immer für Sie da
Gernot Ensinger, M.Sc.
