CALB2 Antibody - N-terminal region : HRP

CALB2 Antibody - N-terminal region : HRP
Artikelnummer
AVIARP58600_P050-HRP
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: HRP: Horseradish Peroxidase

Description of Target: CALB2 is an intracellular calcium-binding protein belonging to the troponin C superfamily. Members of this protein family have six EF-hand domains which bind calcium. This gene encodes an intracellular calcium-binding protein belonging to the troponin C superfamily. Members of this protein family have six EF-hand domains which bind calcium. Three alternatively spliced transcript variants that encode different proteins have been described.

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human CALB2

Key Reference: Alaeddini,M., (2008) Histopathology 52 (3), 299-304

Molecular Weight: 30kDa

Peptide Sequence: Synthetic peptide located within the following region: IIGEEDLPSEEVDQELIEDSQWEEILKQPCPSQYSAIKEEDLVVWVDPLD

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: Calretinin

Protein Size: 271

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP58600_P050-HRP
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP58600_P050-HRP
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Rabbit, Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 794
Wirt Rabbit
Konjugat Conjugated, HRP
Produktinformation (PDF) Download
MSDS (PDF)
×