CALR3 Antibody - N-terminal region : FITC

Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: Calreticulins, such as CALR3, are Ca(2+)-binding chaperones localized mainly in the endoplasmic/sarcoplasmic reticulum.Calreticulins, such as CALR3, are Ca(2+)-binding chaperones localized mainly in the endoplasmic/sarcoplasmic reticulum Persson et al. (2002) [PubMed 12384296].[supplied by OMIM]. PRIMARYREFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP 1-4 BC014595.2 1-4 5-443 DB459545.1 7-445 444-528 BP370084.1 424-508 529-1034 BC014595.2 529-1034 1035-1035 AC008764.9 27895-27895 c 1036-1273 BC014595.2 1036-1273 1274-1285 DB510196.1 313-324

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human CALR3

Key Reference: Hayashi,E., (2007) Clin. Cancer Res. 13 (21), 6267-6274

Molecular Weight: 42kDa

Peptide Sequence: Synthetic peptide located within the following region: MAGPQQQPPYLHLAELTASQFLEIWKHFDADGNGYIEGKELENFFQELEK

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Calreticulin-3

Protein Size: 384

Purification: Affinity Purified

• Artikelnummer: AVIARP58601_P050FITC
• Hersteller: Aviva Systems Biology
• Hersteller Artikelnummer: ARP58601_P050-FITC
• Verpackungseinheit: 100μl
• Mengeneinheit: STK
• Reaktivität: Human, Mouse (Murine), Rat (Rattus), Pig (Porcine), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
• Klonalität: Polyclonal
• Methode: Western Blotting
• Human Gene ID: 125972
• Wirt: Rabbit
• Konjugat: Conjugated, FITC