English
CAMK1D Antibody - middle region : HRP
CAMK1D Antibody - middle region : HRP
Artikelnummer
AVIARP57405_P050-HRP
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology
Verfügbarkeit:
wird geladen...
Preis wird geladen...
Conjugation: HRP: Horseradish Peroxidase
Description of Target: This gene encodes a member of the Ca2+/calmodulin-dependent protein kinase 1 subfamily of serine/threonine kinases. The encoded protein may be involved in the regulation of granulocyte function through the chemokine signal transduction pathway. Alternatively spliced transcript variants encoding different isoforms of this gene have been described.
Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human CAMK1D
Molecular Weight: 42kDa
Peptide Sequence: Synthetic peptide located within the following region: KNIHESVSAQIRKNFAKSKWRQAFNATAVVRHMRKLHLGSSLDSSNASVS
Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.
Protein Name: Calcium/calmodulin-dependent protein kinase type 1D
Protein Size: 385
Purification: Affinity Purified
Description of Target: This gene encodes a member of the Ca2+/calmodulin-dependent protein kinase 1 subfamily of serine/threonine kinases. The encoded protein may be involved in the regulation of granulocyte function through the chemokine signal transduction pathway. Alternatively spliced transcript variants encoding different isoforms of this gene have been described.
Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human CAMK1D
Molecular Weight: 42kDa
Peptide Sequence: Synthetic peptide located within the following region: KNIHESVSAQIRKNFAKSKWRQAFNATAVVRHMRKLHLGSSLDSSNASVS
Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.
Protein Name: Calcium/calmodulin-dependent protein kinase type 1D
Protein Size: 385
Purification: Affinity Purified
| Artikelnummer | AVIARP57405_P050-HRP |
|---|---|
| Hersteller | Aviva Systems Biology |
| Hersteller Artikelnummer | ARP57405_P050-HRP |
| Green Labware | Nein |
| Verpackungseinheit | 100μl |
| Mengeneinheit | STK |
| Reaktivität | Human, Mouse (Murine), Rat (Rattus), Pig (Porcine), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine) |
| Klonalität | Polyclonal |
| Methode | Western Blotting |
| Human Gene ID | 57118 |
| Wirt | Rabbit |
| Produktinformation (PDF) | Download |
| MSDS (PDF) |
|
Verwandte Artikel
Markieren Sie die Artikel, um Sie dem Warenkorb hinzuzufügen oder
Immer für Sie da
Gernot Ensinger, M.Sc.
