Camk2b Antibody - middle region : HRP

Conjugation: HRP: Horseradish Peroxidase

Description of Target: Camk2b is a beta subunit of calcium/calmodulin-dependent protein kinase II; It may be involved in retinal development,

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of Rat Camk2b

Molecular Weight: 64kDa

Peptide Sequence: Synthetic peptide located within the following region: DIVAREYYSEADASHCIQQILEAVLHCHQMGVVHRDLKPENLLLASKCKG

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: Calcium/calmodulin-dependent protein kinase II, beta 3 isoform EMBL CAA58289.1

Protein Size: 589

Purification: Affinity Purified

Subunit: beta

• Artikelnummer: AVIARP55353_P050-HRP
• Hersteller: Aviva Systems Biology
• Hersteller Artikelnummer: ARP55353_P050-HRP
• Green Labware: Nein
• Verpackungseinheit: 100μl
• Mengeneinheit: STK
• Reaktivität: Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Yeast, Horse (Equine)
• Klonalität: Polyclonal
• Methode: Western Blotting
• Human Gene ID: 24245
• Wirt: Rabbit